Pyridoxal hydrochloride
CAS No. 65-22-5
Pyridoxal hydrochloride( —— )
Catalog No. M19654 CAS No. 65-22-5
The 4-carboxyaldehyde form of vitamin B6 which is converted to pyridoxal phosphate which is a coenzyme for synthesis of amino acids neurotransmitters (serotonin norepinephrine) sphingolipids aminolevulinic acid.
The 4-carboxyaldehyde form of vitamin B6 which is converted to pyridoxal phosphate which is a coenzyme for synthesis of amino acids neurotransmitters (serotonin norepinephrine) sphingolipids aminolevulinic acid.
Purity : >98% (HPLC)
COA
Datasheet
HNMR
HPLC
MSDS
Handing Instructions
Size | Price / USD | Stock | Quantity |
500MG | 37 | In Stock |
|
1G | Get Quote | In Stock |
|
Biological Information
-
Product NamePyridoxal hydrochloride
-
NoteResearch use only, not for human use.
-
Brief DescriptionThe 4-carboxyaldehyde form of vitamin B6 which is converted to pyridoxal phosphate which is a coenzyme for synthesis of amino acids neurotransmitters (serotonin norepinephrine) sphingolipids aminolevulinic acid.
-
DescriptionThe 4-carboxyaldehyde form of vitamin B6 which is converted to pyridoxal phosphate which is a coenzyme for synthesis of amino acids neurotransmitters (serotonin norepinephrine) sphingolipids aminolevulinic acid.
-
In Vitro——
-
In Vivo——
-
Synonyms——
-
PathwayOthers
-
TargetOther Targets
-
RecptorOthers
-
Research Area——
-
Indication——
Chemical Information
-
CAS Number65-22-5
-
Formula Weight203.62
-
Molecular FormulaC8H10ClNO3
-
Purity>98% (HPLC)
-
SolubilityDMSO:10 mM
-
SMILESCl.Cc1ncc(CO)c(C=O)c1O
-
Chemical Name——
Shipping & Storage Information
-
Storage(-20℃)
-
ShippingWith Ice Pack
-
Stability≥ 2 years
Reference
1.Rajamohan F Nelms L Joslin D L et al. cDNA cloning expression purification distribution and characterization of biologically active canine alanine aminotransferase-1.[J]. Protein Expr Purif 2006 48(1):81-89.
molnova catalog
related products
-
Exendin-4 peptide de...
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.
-
DPC AJ1951
Potent 14 amino acid peptide agonist of the parathyroid hormone (PTH) receptor (EC50 = 26 nM).
-
1-Ethoxycarbonyl-bet...
1-Ethoxycarbonyl-β-carboline is a natural product for research related to life sciences.