Pyridoxal hydrochloride

CAS No. 65-22-5

Pyridoxal hydrochloride( —— )

Catalog No. M19654 CAS No. 65-22-5

The 4-carboxyaldehyde form of vitamin B6 which is converted to pyridoxal phosphate which is a coenzyme for synthesis of amino acids neurotransmitters (serotonin norepinephrine) sphingolipids aminolevulinic acid.

The 4-carboxyaldehyde form of vitamin B6 which is converted to pyridoxal phosphate which is a coenzyme for synthesis of amino acids neurotransmitters (serotonin norepinephrine) sphingolipids aminolevulinic acid.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
500MG 37 In Stock
1G Get Quote In Stock

Biological Information

  • Product Name
    Pyridoxal hydrochloride
  • Note
    Research use only, not for human use.
  • Brief Description
    The 4-carboxyaldehyde form of vitamin B6 which is converted to pyridoxal phosphate which is a coenzyme for synthesis of amino acids neurotransmitters (serotonin norepinephrine) sphingolipids aminolevulinic acid.
  • Description
    The 4-carboxyaldehyde form of vitamin B6 which is converted to pyridoxal phosphate which is a coenzyme for synthesis of amino acids neurotransmitters (serotonin norepinephrine) sphingolipids aminolevulinic acid.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    Others
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    65-22-5
  • Formula Weight
    203.62
  • Molecular Formula
    C8H10ClNO3
  • Purity
    >98% (HPLC)
  • Solubility
    DMSO:10 mM
  • SMILES
    Cl.Cc1ncc(CO)c(C=O)c1O
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

1.Rajamohan F Nelms L Joslin D L et al. cDNA cloning expression purification distribution and characterization of biologically active canine alanine aminotransferase-1.[J]. Protein Expr Purif 2006 48(1):81-89.
molnova catalog
related products
  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

  • DPC AJ1951

    Potent 14 amino acid peptide agonist of the parathyroid hormone (PTH) receptor (EC50 = 26 nM).

  • 1-Ethoxycarbonyl-bet...

    1-Ethoxycarbonyl-β-carboline is a natural product for research related to life sciences.